Conus ebraeus A superfamily conotoxin Eb1.8 precursor, mRNA, complete cds. (N02421) Nucleic Acid Card

General Information
Name Conus ebraeus A superfamily conotoxin Eb1.8 precursor, mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcttggcaaccgctgtcgtttccttcacttcagatcgtgc
atctcgtggcaggaatgccgcagccaaagtgtttgaccgg
atcgctctgatcgctacacgcgaatgctgtgccaatcctc
aatgttgggcgaagaattgtcggggaagacgctgctactc
caggactctctga
Sequence translation MGMRMMFTVFLLVVLATAVVSFTSDRASRGRNAAAKVFDR
IALIATRECCANPQCWAKNCRGRRCYSRTL-

References

Internal links
Proteins Encoded Eb1.3 precursor

External links
Ncbi
GenBank JX293435

Tools