Conus emaciatus A superfamily conotoxin Ec1.1 precursor, mRNA, complete cds. (N02422) Nucleic Acid Card

General Information
Name Conus emaciatus A superfamily conotoxin Ec1.1 precursor, mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcctggcaaccgctgtcgtttccttcactttagatcgtcc
atcagatggcggggatgccgcagccaaagcgtttgacctg
atggctctgaccgccagactagattgctgtgacattcatg
cctgttggtcggcgcatccagaactttgtggaggaagacg
ctga
Sequence translation MGMRMMFTVFLLVVLATAVVSFTLDRPSDGGDAAAKAFDL
MALTARLDCCDIHACWSAHPELCGGRR-

References

Internal links
Proteins Encoded Ec1.1 precursor

External links
Ncbi
GenBank JX293436

Tools