Conus terebra A superfamily conotoxin Tr1.1 precursor, mRNA, complete cds. (N02428) Nucleic Acid Card

General Information
Name Conus terebra A superfamily conotoxin Tr1.1 precursor, mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgggcatgcggatgatgttcatcgcgtttctgttggttg
tcttcgcatcctctgtcactttagatcgtgcatctcatgg
caggtatgccgcagtcgtcgacagagcgtctgccccgatt
tctcaggccatccttcgagactgctgttccaatcctcctt
gtgcccataataacccagactgtcgttaa
Sequence translation MGMRMMFIAFLLVVFASSVTLDRASHGRYAAVVDRASAPI
SQAILRDCCSNPPCAHNNPDCR-

References

Internal links
Proteins Encoded Tr1.1 precursor

External links
Ncbi
GenBank JX293442

Tools