Conus miles O2 superfamily conotoxin Mi7.6 precursor, mRNA, complete cds. (N02441) Nucleic Acid Card

General Information
Name Conus miles O2 superfamily conotoxin Mi7.6 precursor, mRNA, complete cds.
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgcttcttgttgctgctgtac
tgttgtcgatccaggccctaaatcaagaaaaacaccaacg
ggcaaagatcaacttgctttcaaagagaaagccacctgct
gagcgttggtggcggtggggaggatgcatggcttggtttg
ggctttgttcgagggactcggaatgttgttctaatagttg
tgacgtaacgtgc
tagtctacttatttgtttactcgtaaa
gattattcaaaaggaaaacaaaagccttgaagtctctgaa
gagga
Sequence translation MEKLTILLLVAAVLLSIQALNQEKHQRAKINLLSKRKPPA
ERWWRWGGCMAWFGLCSRDSECCSNSCDVTC

References

Internal links
Proteins Encoded Mi7.6 precursor

External links
Ncbi
GenBank JX293456

Tools