Conus terebra O2 superfamily conotoxin Tr7.1 precursor, mRNA, complete cds. (N02442) Nucleic Acid Card

General Information
Name Conus terebra O2 superfamily conotoxin Tr7.1 precursor, mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atggagaaactgacaattctgcttcttgttgctgctgtac
tgacgtcgacccaggccctgattcaagatcgtaaagaacg
tcaaaaggcggagatcaactttttgtcaaaaagaaaatca
actttttggcgttggtgggatggcgattgcaggacttggc
gtgcgccgtgtaaccctggcgtggaatgttgtactgatgt
atgtagacacggccgctgtgtgttctgg
tgatgaactcag
gccaaaagccttgaagtctctgaagagga
Sequence translation MEKLTILLLVAAVLTSTQALIQDRKERQKAEINFLSKRKS
TFWRWWDGDCRTWRAPCNPGVECCTDVCRHGRCVFW

References

Internal links
Proteins Encoded Tr7.1 precursor

External links
Ncbi
GenBank JX293457

Tools