Conus varius XV conotoxin Vr15a precursor, mRNA, complete cds. (N02449) Nucleic Acid Card

General Information
Name Conus varius XV conotoxin Vr15a precursor, mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atggagaaacttacagtcctgattcttgttgccactgtcc
tgttgacgatccaggtcctgggtcaaagtgatggagataa
acatctgaagaggaggcccaaacaatacgcaaccaaacgt
ctctcggcactcatgaaggggcaccgtcaatgcacaggtg
cggggttcgaatgtgaggagacccccgaatgttgcccgaa
tcttacgtgcaaatgctctggcagtccactttgcgctcgt
tatagatgtaaacca
taatgacctcatgtcatctcatatc
aatacatcagagccacaacc
Sequence translation MEKLTVLILVATVLLTIQVLGQSDGDKHLKRRPKQYATKR
LSALMKGHRQCTGAGFECEETPECCPNLTCKCSGSPLCAR
YRCKP

References

Internal links
Proteins Encoded Vr15a precursor

External links
Ncbi
GenBank JX293464

Tools