Conus terebra O3 superfamily conotoxin Tr7.5 precursor, mRNA, complete cds. (N02457) Nucleic Acid Card

General Information
Name Conus terebra O3 superfamily conotoxin Tr7.5 precursor, mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgtcaggattgggaatcatggtgctaacccttctacttc
tcgtgttcatggtaaccagtcatcaggatagtggagagaa
gcgggcgactcgaaggaacgcaatcaacatcggatggaga
agatcaatcattcggagagcatcattagatgaggagtgca
acgagtactgcaagcagcggaccaagaactgctgcggtaa
aacaaatgaagaacctgtatgtgcacggcgctgcctcgga

tagtttctgtacactgtctcattcattattttatcagtac
aagtgtaaacgagatctgtcagaaagtcgaaggttgctcg
taagttgataagcattgtttactgggacgaacggatttga
gatg
Sequence translation MSGLGIMVLTLLLLVFMVTSHQDSGEKRATRRNAINIGWR
RSIIRRASLDEECNEYCKQRTKNCCGKTNEEPVCARRCLG

References

Internal links
Proteins Encoded Tr7.5 precursor

External links
Ncbi
GenBank JX293471

Tools