Conus striatus O3 superfamily conotoxin S6.17 precursor, mRNA, complete cds. (N02458) Nucleic Acid Card

General Information
Name Conus striatus O3 superfamily conotoxin S6.17 precursor, mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgtcaggattgggaatcatggtgctaacccttctacttc
ttgtgttcatggcaaccagtcgtcaggatgcaggagagaa
gcaggcgacgcaaagggacgcaatcaaagtcatacggaga
tcagtcattcagagaaaagcaactgaggagtgcgaagagg
tctgtgagcaggatgaaaagcactgctgtgacggaagtga
tggaacccccagatgtaccagtcgttgctttgga
tagttt
ctgtacactgtctcattcattattttatcagtacaagtgt
aaacgagacgtgtcagaaagtcgaaggttgtgcataattt
gataaacatagtttactgggacgaacggatttgagatg
Sequence translation MSGLGIMVLTLLLLVFMATSRQDAGEKQATQRDAIKVIRR
SVIQRKATEECEEVCEQDEKHCCDGSDGTPRCTSRCFG

References

Internal links
Proteins Encoded S6.17 precursor

External links
Ncbi
GenBank JX293472

Tools