Conus striatus S superfamily conotoxin S8.1 precursor, mRNA, complete cds. (N02461) Nucleic Acid Card

General Information
Name Conus striatus S superfamily conotoxin S8.1 precursor, mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgaaaatgggagctatgtttgtccttttgcttc
ttttcatcctgccatccagccagcaggaaggagatgtcca
ggcaagaaaaacgcacctgaagagaggcttctacggtact
ctggcaatgtctaccagaggatgctctggcacttgccatc
gtcgtgaggacggcaagtgtcggggtacttgcgactgctc
cggatacagctattgtcgctgcggtgacgctcaccatttt
taccgaggatgcacgtgttcatgtcaaggt
tgattaattg
actcttttaactcgttgaacgattaaaaaaaaattttaga
gcaatatgttacagaaaaaccgaagactctgagacttctc
gtaataaatccg
Sequence translation MMLKMGAMFVLLLLFILPSSQQEGDVQARKTHLKRGFYGT
LAMSTRGCSGTCHRREDGKCRGTCDCSGYSYCRCGDAHHF
YRGCTCSCQG

References

Internal links
Proteins Encoded S8.1 precursor

External links
Ncbi
GenBank JX293475

Tools