Conus striatus S superfamily conotoxin S8.2 precursor, mRNA, complete cds. (N02462) Nucleic Acid Card

General Information
Name Conus striatus S superfamily conotoxin S8.2 precursor, mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgaaaatgggagctatgtttgtccttttgcttc
ttttcaccctggcatccgtccagcaggaagatgtccaggc
aaggaaaacacgcctgaagagagacttccatcgtgctctg
agacagtctcccttaggatgccctggcacttgtggtaaag
gcggcaagtgtgtggggtcttgcgaatgcactatgtataa
aaattgttactgcagtaacaatggcatacgtcaaccagga
tgctcgtgtacatgtccaactcgt
tgaacgatttaaaaaa
tctagagcaatatgttgcagaaaaaccgaaaactctaaga
cttctcgtaataaatccg
Sequence translation MMLKMGAMFVLLLLFTLASVQQEDVQARKTRLKRDFHRAL
RQSPLGCPGTCGKGGKCVGSCECTMYKNCYCSNNGIRQPG
CSCTCPTR

References

Internal links
Proteins Encoded S8.2 precursor

External links
Ncbi
GenBank JX293476

Tools