Conus textile T superfamily conotoxin Tx5.12 precursor, mRNA, complete cds. (N02464) Nucleic Acid Card

General Information
Name Conus textile T superfamily conotoxin Tx5.12 precursor, mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcattcttctgctgctga
ttgcatctacacctagcattgatgcccgaccgaagaccaa
agatgatatgcccctggcatctttcaacgataatgcaaag
cgaatcctgcaaatactttcgaggaaaccctgttgcagca
ttcacgacagttcgtgctgtggtttaggataa
Sequence translation MLCLPVFIILLLLIASTPSIDARPKTKDDMPLASFNDNAK
RILQILSRKPCCSIHDSSCCGLG-

References

Internal links
Proteins Encoded Tx5b precursor

External links
Ncbi
GenBank JX293478

Tools