Conus textile T superfamily conotoxin Tx5.14 precursor, mRNA, complete cds. (N02466) Nucleic Acid Card

General Information
Name Conus textile T superfamily conotoxin Tx5.14 precursor, mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccagtcttcatcatccttctgctgttgg
cttcacctgcagctccaatgccgtctgaaacgaacctcca
aagcgatttcactctcgcagaccctcgagatgccgatgtg
aaaaacagaggaatatttgccttggccaaaagcgtgtgtt
gtaccgctgcaaaactctcattttgctgttga
Sequence translation MLCLPVFIILLLLASPAAPMPSETNLQSDFTLADPRDADV
KNRGIFALAKSVCCTAAKLSFCC-

References

Internal links
Proteins Encoded Tx5.14 precursor

External links
Ncbi
GenBank JX293480

Tools