Conus striatus T superfamily conotoxin S5.3 precursor, mRNA, complete cds. (N02470) Nucleic Acid Card

General Information
Name Conus striatus T superfamily conotoxin S5.3 precursor, mRNA, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtttcccagtcttcgttattcttctgctgctga
ttgcatctgcacctagtgttgatgcccgaccgaagaccaa
agatggtatgcccctggcatctttccacgataatgcaact
cgaaacctgcaaatactttgctgcaaacatacccccgcat
gctgtacaggaaaa
tgaccttggatgagacccctgcaaac
tgtccttggatgtgagatttggaaagcagactgttccttt
cgcacgtgttcgtggaatttcgaatggtcgttaacaacac
gctgccacttgc
Sequence translation MRCFPVFVILLLLIASAPSVDARPKTKDGMPLASFHDNAT
RNLQILCCKHTPACCTGK

References

Internal links
Proteins Encoded S5.3 precursor

External links
Ncbi
GenBank JX293484

Tools