Conus miles T superfamily conotoxin Mi5.1 precursor, mRNA, complete cds. (N02472) Nucleic Acid Card

General Information
Name Conus miles T superfamily conotoxin Mi5.1 precursor, mRNA, complete cds.
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtctcccagtcttcatcattcttctgttgctga
ttccatctgcatctagcgttgatgtccaaccgttgaccaa
agatgatgtgcccctggcatctttcctcgctaatgcaaga
cgaaccctacaaagtctctggatgacacgcaggtgctgtc
caaaaaaaccttattgctgtccaggtggaaaatga
agaga
aatgattttggatgagacccctgcaaactgtcccngatgt
gagatttggaaagcagactgttcctttcgcacgtgctcgt
gggatttcgaacggtcgttaacaacacgctgccacttgc
Sequence translation MRCLPVFIILLLLIPSASSVDVQPLTKDDVPLASFLANAR
RTLQSLWMTRRCCPKKPYCCPGGK-

References

Internal links
Proteins Encoded Mi5.1 precursor

External links
Ncbi
GenBank JX293486

Tools