Conus terebra T superfamily conotoxin Tr5.2 precursor, mRNA, complete cds. (N02477) Nucleic Acid Card

General Information
Name Conus terebra T superfamily conotoxin Tr5.2 precursor, mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgcgctgcctcccagtcttcatcattcttctgctgctga
ttccatctgcacctagcactgatgtccaaccgaagaccaa
agatgatgtgcccctggcatctttccgtgatagtgtaaag
cgaatcctacaaagacaatgctgcccaacgatttctgagt
gctgtcgtgtagga
taaagggaaatgactttggataagac
ccctgcgaactgtccctggatgtgaaatttggaaagcaga
ctgttcctttcgcacgtgttcgtggaatttcgaatggtcg
ttaacaacacgctgccacttgc
Sequence translation MRCLPVFIILLLLIPSAPSTDVQPKTKDDVPLASFRDSVK
RILQRQCCPTISECCRVG

References

Internal links
Proteins Encoded Tr5.2 precursor

External links
Ncbi
GenBank JX293491

Tools