Conus terebra T superfamily conotoxin Tr5.4 precursor, mRNA, complete cds. (N02479) Nucleic Acid Card

General Information
Name Conus terebra T superfamily conotoxin Tr5.4 precursor, mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgctgtgtcttccagtcttcatcatccttctgctgttgg
cttcacctgcagctccaacgccgtttgaaacgaacctcca
aagcgacttgactcgtgcaggccctagagatgctgatatg
aaaagcatgcgaggcattttttccaccctatgctgcggtg
tcggcatcaattcttgctgctga
Sequence translation MLCLPVFIILLLLASPAAPTPFETNLQSDLTRAGPRDADM
KSMRGIFSTLCCGVGINSCC-

References

Internal links
Proteins Encoded Tr5.4 precursor

External links
Ncbi
GenBank JX293493

Tools