Conus terebra T superfamily conotoxin Tr5.6 precursor, mRNA, complete cds. (N02481) Nucleic Acid Card

General Information
Name Conus terebra T superfamily conotoxin Tr5.6 precursor, mRNA, complete cds.
Organism Conus terebra
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgctgtgtcttccagtcttcatcatccttctgctgttgg
tttcacctgcggctactctgcgtgtgcaatcaaagctgga
aagatttttgactcagcagtctcctagagattttgcgaag
aaagttatgcagctacgttattacaactggattgactgct
gttttgatggcgcttgctgcaattga
Sequence translation MLCLPVFIILLLLVSPAATLRVQSKLERFLTQQSPRDFAK
KVMQLRYYNWIDCCFDGACCN-

References

Internal links
Proteins Encoded Tr5.6 precursor

External links
Ncbi
GenBank JX293495

Tools