Conus vexillum T superfamily conotoxin Vx5.1 precursor, mRNA, complete cds. (N02482) Nucleic Acid Card

General Information
Name Conus vexillum T superfamily conotoxin Vx5.1 precursor, mRNA, complete cds.
Organism Conus vexillum
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtctcccagtcttcatcattcttctgctgctga
ttctacctgcacctagcgctgatgtccaaccgaagaccaa
agatcatgtgcacctggcatctttccttgatagtgcaaag
cgaaccgtaagaggacattgctgcccatattaccctcagt
gctgtcctagtgga
tgaagggaaatgactttggataagac
ccctgcgagctgtctctggatgtgaaatttggaaagcaga
ctgttcctttcgcatgtgttcgtggaatttcgaatggtcg
ttaacaacacgctgccacttgc
Sequence translation MRCLPVFIILLLLILPAPSADVQPKTKDHVHLASFLDSAK
RTVRGHCCPYYPQCCPSG

References

Internal links
Proteins Encoded Vx5.1 precursor

External links
Ncbi
GenBank JX293496

Tools