Conus caracteristicus T superfamily conotoxin Ca5.5 precursor, mRNA, complete cds. (N02484) Nucleic Acid Card

General Information
Name Conus caracteristicus T superfamily conotoxin Ca5.5 precursor, mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgcttcccagtcttcatcattcttctgttactga
tttcatctgcatctaacgttgatgcccaacagaagaccaa
agatgatgcgtccctggcatctttccaagataatgcaagg
cgaaccctacaaagtctctggatgacacgcggatgctgtc
caggaaatgttttgtgctgtggaaaa
tgaagagaaatgac
tttggatgagacccctgcaaactgtccgtggatgtgatat
ttggaaagcagactgttcctttcgcacgtgctcgtgggat
ttcgaacggtcgttaacaacacgctgccacttgc
Sequence translation MRCFPVFIILLLLISSASNVDAQQKTKDDASLASFQDNAR
RTLQSLWMTRGCCPGNVLCCGK

References

Internal links
Proteins Encoded Ca5.5 precursor

External links
Ncbi
GenBank JX293498

Tools