Conus capitaneus T superfamily conotoxin Cap5.1 precursor, mRNA, complete cds. (N02486) Nucleic Acid Card

General Information
Name Conus capitaneus T superfamily conotoxin Cap5.1 precursor, mRNA, complete cds.
Organism Conus capitaneus
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcattcttctgttactga
tttcatctgcatctaacgttgatgcccaacagaagaccaa
agatgatgcgtccctggcacctttccaagataatgcaagg
cgaaccctacaaagtctctggatgacacgcggatgctgtc
caggaaatgttttgtgctgtggaaaatga
Sequence translation MLCLPVFIILLLLISSASNVDAQQKTKDDASLAPFQDNAR
RTLQSLWMTRGCCPGNVLCCGK-

References

Internal links
Proteins Encoded Cap5.1 precursor

External links
Ncbi
GenBank JX293500

Tools