Conus coronatus T superfamily conotoxin Co5.1 precursor, mRNA, complete cds. (N02487) Nucleic Acid Card

General Information
Name Conus coronatus T superfamily conotoxin Co5.1 precursor, mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccagtcttcatcatccttctgctgttgg
cttcacctgcagttccagagccttttgaaacgaagctcca
aagagatttgactcgtgcagatgccgatatggaaaacctt
gctaaagtccgaaaagctgtttgctgtgaagtccttcctg
gcactgattgctgctttggctaa
Sequence translation MLCLPVFIILLLLASPAVPEPFETKLQRDLTRADADMENL
AKVRKAVCCEVLPGTDCCFG-

References

Internal links
Proteins Encoded Co5.1 precursor

External links
Ncbi
GenBank JX293501

Tools