Conus tessulatus T superfamily conotoxin Ts5.7 precursor, mRNA, complete cds. (N02488) Nucleic Acid Card

General Information
Name Conus tessulatus T superfamily conotoxin Ts5.7 precursor, mRNA, complete cds.
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcatccttctgctgttgg
cttcacctgcagctccaaacccttttgaaacgaagctcca
aagcgattcgactcgtgcagatgccgatanggaaaccgat
aaaaaccttgatgcagtccgcaaagcaatttgctgcgatg
tctttcctggcactgattgctgtatggggtaa
Sequence translation MLCLPVFIILLLLASPAAPNPFETKLQSDSTRADAD?ETD
KNLDAVRKAICCDVFPGTDCCMG-

References

Internal links
Proteins Encoded Ts5.7 precursor

External links
Ncbi
GenBank JX293502

Tools