Conus quercinus T superfamily conotoxin Qc5.3 precursor, mRNA, complete cds. (N02489) Nucleic Acid Card

General Information
Name Conus quercinus T superfamily conotoxin Qc5.3 precursor, mRNA, complete cds.
Organism Conus quercinus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcatccttctgctgttgg
tttcacctgcggctactctgcgtgtgcaatcaaagctgga
aagatttttgactcagcagtctcctagagattttgcgaag
aaagttatgcagctacgttattacaactggattgactgct
gttttgatggcgattgctgcaattga
Sequence translation MLCLPVFIILLLLVSPAATLRVQSKLERFLTQQSPRDFAK
KVMQLRYYNWIDCCFDGDCCN-

References

Internal links
Proteins Encoded Qc5.3 precursor

External links
Ncbi
GenBank JX293503

Tools