Conus rattus T superfamily conotoxin Rt5.1 precursor, mRNA, complete cds. (N02491) Nucleic Acid Card

General Information
Name Conus rattus T superfamily conotoxin Rt5.1 precursor, mRNA, complete cds.
Organism Conus rattus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcatccttctgctgttgg
tttcacctgcagctactctgcctgtgggatcagaactgca
aagagatttgacccacgaatctcctaaagatttagggatg
agaactgactacctacctttcagggatgtgggcgacgact
gctgttcggacaatgtcggcacatgctgtaaataa
Sequence translation MLCLPVFIILLLLVSPAATLPVGSELQRDLTHESPKDLGM
RTDYLPFRDVGDDCCSDNVGTCCK-

References

Internal links
Proteins Encoded Rt5.1 precursor

External links
Ncbi
GenBank JX293505

Tools