Conus betulinus T superfamily conotoxin Bt5.3 precursor, mRNA, complete cds. (N02494) Nucleic Acid Card

General Information
Name Conus betulinus T superfamily conotoxin Bt5.3 precursor, mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcatcctgccggtccttt
catctgcagctggttttcctgtggaatcagagctgcaaag
agatttgactcaggaatctcctaaagatttggggatgaga
aatgaacaccaacttttgaagaaagtggccgacgactgct
gtgtaggcaaggtcggcacttgctgccgataa
Sequence translation MLCLPVFIILPVLSSAAGFPVESELQRDLTQESPKDLGMR
NEHQLLKKVADDCCVGKVGTCCR-

References

Internal links
Proteins Encoded Bt5.3 precursor

External links
Ncbi
GenBank JX293508

Tools