Conus betulinus T superfamily conotoxin Bt5.4 precursor, mRNA, complete cds. (N02495) Nucleic Acid Card

General Information
Name Conus betulinus T superfamily conotoxin Bt5.4 precursor, mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccagtcttcatcatccttctgctgttgg
tttcacctgcagctactctgcctgtgacgtcaaagctgca
cgggcttttgactcggcgatctcttaagaatttttggaag
agaaatttgtacctacgtgatgaggattgggtcgactgct
gtcacatgccgcgttgctgtgttgaggactaa
Sequence translation MLCLPVFIILLLLVSPAATLPVTSKLHGLLTRRSLKNFWK
RNLYLRDEDWVDCCHMPRCCVED-

References

Internal links
Proteins Encoded Bt5.4 precursor

External links
Ncbi
GenBank JX293509

Tools