Conus varius T superfamily conotoxin Vr5.1 precursor, mRNA, complete cds. (N02496) Nucleic Acid Card

General Information
Name Conus varius T superfamily conotoxin Vr5.1 precursor, mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgctgtgtcttccggtcttcatcatccttctgctgttgg
tttcacctgcagctccaatgccgtctgaaacgaacctcca
aagcgatttcactctcgcagaccctcgagatgccgatgtg
aaaaacagaggaatacttgaattggccaaaaccgtgtgct
gttccgctacaggaatttcaatttgctgttga
Sequence translation MLCLPVFIILLLLVSPAAPMPSETNLQSDFTLADPRDADV
KNRGILELAKTVCCSATGISICC-

References

Internal links
Proteins Encoded Vr5.1 precursor

External links
Ncbi
GenBank JX293510

Tools