Conus lividus T superfamily conotoxin Lv5.7 precursor, mRNA, complete cds. (N02503) Nucleic Acid Card

General Information
Name Conus lividus T superfamily conotoxin Lv5.7 precursor, mRNA, complete cds.
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcatccttctgctgttgg
tttcacctgcggctaccctgcgtgtgcaatcaaagctgga
aagatttttgactcagcagtctcctagagattttgcgaag
agtgttatgcagctacttcattacaactggatcgactgct
gtaattatggcgtaagcgattgctgtattgggtaa
Sequence translation MLCLPVFIILLLLVSPAATLRVQSKLERFLTQQSPRDFAK
SVMQLLHYNWIDCCNYGVSDCCIG-

References

Internal links
Proteins Encoded Lv5.7 precursor

External links
Ncbi
GenBank JX293517

Tools