Conus emaciatus T superfamily conotoxin Ec5.1 precursor, mRNA, complete cds. (N02504) Nucleic Acid Card

General Information
Name Conus emaciatus T superfamily conotoxin Ec5.1 precursor, mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgctgtgtcttccggtcttcatcactcttctgctgctga
tttcatctgcacctagcgttgatgcccaaacaaagaccaa
gaattttctgactctcgcatctttacgagattttgcaaag
aaatccccgaaaagacttacgcaatttgaatgctgctcag
aagttttctcatgctgtcgctga
Sequence translation MLCLPVFITLLLLISSAPSVDAQTKTKNFLTLASLRDFAK
KSPKRLTQFECCSEVFSCCR-

References

Internal links
Proteins Encoded Ec5.1 precursor

External links
Ncbi
GenBank JX293518

Tools