Conus ebraeus T superfamily conotoxin Eb5.1 precursor, mRNA, complete cds. (N02505) Nucleic Acid Card

General Information
Name Conus ebraeus T superfamily conotoxin Eb5.1 precursor, mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgcgctgtttcccagtcttcgtcgttcttctgctgctga
ttgcatctgcacctagcgttgatgcccaaccgaagaccaa
agatgatgtgcccctggcacctttgcacgacaatatacag
aatactctacaaacacttcggaagaaagtctgctgccgcc
cgatgcaggattgctgttcagggaaa
tgaagggaaatgaa
tttggatgagacccctgcgaactgtccctggatgtgagat
ttggaaagcagactgttcctttcgcacgtgttcgtggaat
ttcgaatggtcgttaacaacacgctgccacttgc
Sequence translation MRCFPVFVVLLLLIASAPSVDAQPKTKDDVPLAPLHDNIQ
NTLQTLRKKVCCRPMQDCCSGK

References

Internal links
Proteins Encoded Eb5.1 precursor

External links
Ncbi
GenBank JX293519

Tools