Conus ebraeus T superfamily conotoxin Eb5.3 precursor, mRNA, complete cds. (N02507) Nucleic Acid Card

General Information
Name Conus ebraeus T superfamily conotoxin Eb5.3 precursor, mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgcgctgcttcccagtcttcgttattcttctgctgctga
ttgcatctgcacctagtgttgatgcccgaccgaagaccaa
agatggtatgcccctggcatctttccacgataatgcaact
cgaaacctgcaaatactttgctgcaaacatacccccgcat
gctgtaaa
tgaccttggatgagacccctgcaaactgtcct
tggatgtgagatttggaaagcagactgttcctttcgcacg
tgttcgtggaatttcgaatggtcgttaacaacacgctgcc
acttgc
Sequence translation MRCFPVFVILLLLIASAPSVDARPKTKDGMPLASFHDNAT
RNLQILCCKHTPACCK

References

Internal links
Proteins Encoded Eb5.3 precursor

External links
Ncbi
GenBank JX293521

Tools