Conus ebraeus T superfamily conotoxin Eb5.5 precursor, mRNA, complete cds. (N02509) Nucleic Acid Card

General Information
Name Conus ebraeus T superfamily conotoxin Eb5.5 precursor, mRNA, complete cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
atgcgctgtttcccagtcttcgttattcttctgctgctga
ttgcatctgcacctagtgttgatgcccgaccgaagaccaa
agatggtatgcccctggcatctttccacgataatgcaact
cgaaacctgcaaatactttgctgcaagcatacccccgcat
gctgtacaggaaaa
tgaccttggatgagacccctgcaaac
tgtccttggatgtgagatttggaaagcagactgttccttt
cgcacgtgttcgtggaatttcgaatggtcgttaacaacac
gctgccacttgc
Sequence translation MRCFPVFVILLLLIASAPSVDARPKTKDGMPLASFHDNAT
RNLQILCCKHTPACCTGK

References

Internal links
Proteins Encoded Eb5.5 precursor

External links
Ncbi
GenBank JX293523

Tools