Conus varius A superfamily conotoxin Vr1.1 precursor, gene, complete cds. (N02538) Nucleic Acid Card

General Information
Name Conus varius A superfamily conotoxin Vr1.1 precursor, gene, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgggcatgcggatgatgttcatcctgtttctgttggttg
tcttggcaaccactgtcgtttccttcccctcagatcgtgg
taagtcaatatccaaattgtcatattttgtaacctggaga
cactctgcatttgttgctttgaaccgtggtgtactgcact
gcatttcgttgtattgctttgcagcaaggtgttgagctgt
gtactggtctatgcaatgttcttctgtattgtagtgaatc
atgctgttctgtaatcttttaactgtattgcattgtcttt
tactgcgttgtaaagaatcatgttttgatgtgctgtactt
ggggttattgaactaatatgtaccgtcttgctgtaaatca
ttatgcttaccattgtaatgtactgaatttaatgtatatt
tgtggatcattcgaatccatatgcacatggtataatattc
tgtttacattatatcgtgttagtatttcttcatgcattgc
cttgtattacagtttattacaacacattatatagtgttgt
attgctgatgatgtttcatattatatcatgctgttttgtt
gttcccagacaatttgaggacagtcacaccaaaatatgat
tgtttcattcagctagctgaatgagacataaagttaaaaa
ccattctaaagtacaattaccgtgtgccctattgttattc
ttattgatattagttgtagcagcagtatcatcatcatcat
catcatcatcatcatcatcatcgtcatcatcatcatcatc
atcatcatcatcattactactagtcgtcgaagtagtagta
gttgcagtaaaatgagtagtagtggtagtagtacttatat
atcgcctgtcttcagttaaaaacgtagttcagaatgtttc
acaatccacgcacgcatttcaacatcaggctgcctgcttg
ggtacaccagccaaagggctgcctgcaggagcttcattaa
gttgtttttagtgtcgttcaattactatcaggcattctgt
tcttttattatttttttctcagattttgttttcacgcagt
gcgcatactcatcatcatcatcatcatcatcatcatcatc
atcatcgtcatcgtcactactactactagaaatagatcca
gttgtagtaataggagtagtacctgtatttcacgcagagc
acttgcagattttttttttcacgcagtacgtgtgctatca
atgccaaaggccaaactggccttctcttccttaagttgac
gatgggattttacatctgtctaagctgttctgtctgtctg
tctgtctgtccatctgcctgtttgtgtgtttgtgtgtgtg
tgtgtgtatttctgggtccagcttctgatggcgtgaatac
cgcagccgaactgatcgctcgtgccacctgggactattgc
tgtcccccttatatctgtgacacgcattttccaagtcatt
gtaagtga
atacgctgctgctccaggaccctctgaaccac
gacatgc
Sequence translation MGMRMMFILFLLVVLATTVVSFPSDRGKSISKLSYFVTWR
HSAFVALNRGVLHCISLYCFAARC-AVYWSMQCSSVL--I
MLFCNLLTVLHCLLLRCKESCFDVLYLGLLN-YVPSCCKS
LCLPL-CTEFNVYLWIIRIHMHMV-YSVYIISC-YFFMHC
LVLQFITTHYIVLYC--CFILYHAVLLFPDNLRTVTPKYD
CFIQLAE-DIKLKTILKYNYRVPYCYSY-Y-L-QQYHHHH
HHHHHHHRHHHHHHHHHHYY-SSK---LQ-NE--W--YLY
IACLQLKT-FRMFHNPRTHFNIRLPAWVHQPKGCLQELH-
VVFSVVQLLSGILFFYYFFLRFCFHAVRILIIIIIIIIII
IIVIVTTTTRNRSSCSNRSSTCISRRALADFFFHAVRVLS
MPKAKLAFSSLS-RWDFTSV-AVLSVCLSVHLPVCVFVCV
CVYFWVQLLMA-IPQPN-SLVPPGTIAVPLISVTRIFQVI
VS?

References
Wu,Y., Wang,L., Zhou,M., You,Y., Zhu,X., Qiang,Y., Qin,M., Luo,S., Ren,Z. and Xu,A. (2013) Molecular evolution and diversity of Conus peptide toxins, as revealed by gene structure and intron sequence analyses. PLoS ONE 8

Internal links
Proteins Encoded Vr1.1 precursor

External links
Ncbi
GenBank JX293552

Tools