Conus textile O2 superfamily conotoxin Tx7.31 precursor, mRNA, complete cds. (N02544) Nucleic Acid Card

General Information
Name Conus textile O2 superfamily conotoxin Tx7.31 precursor, mRNA, complete cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaattctgcttctcgttgctgctgtgc
tgatgtcgacccaggccctaattcaagaacaacgccaaaa
ggcaaagatcaacttgttttcaaagagaaagccatctgct
gagcgttggtggggagagaatgactgcagttggacagggc
cttgtacggtgaacgcagaatgttgtcttggtgtttgtga
tgaaacgtgc
tagtctacctttttgctcactcgtaaaatt
cttcaaaagagaacaaaagccttgaagtctctgaagagga
Sequence translation MEKLTILLLVAAVLMSTQALIQEQRQKAKINLFSKRKPSA
ERWWGENDCSWTGPCTVNAECCLGVCDETC

References
Wu,Y., Wang,L., Zhou,M., You,Y., Zhu,X., Qiang,Y., Qin,M., Luo,S., Ren,Z. and Xu,A. (2013) Molecular evolution and diversity of Conus peptide toxins, as revealed by gene structure and intron sequence analyses. PLoS ONE 8

Internal links
Proteins Encoded Tx7.31 precursor

External links
Ncbi
GenBank JX293558

Tools