Conus consors mRNA for A superfamily CnIA precursor, biomaterial CH070619AA-AC. (N02547) Nucleic Acid Card

General Information
Name Conus consors mRNA for A superfamily CnIA precursor, biomaterial CH070619AA-AC.
Organism Conus consors
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
ttggsattcaactgacgagctgcagaccagacggacgtga
aacagcatcgccggcaagtggggatagtacaagacacgca
gaacaaagaagcagagagtctgagaaaataacc
atgggca
tgcggatgatgttcaccgtgtttctgttggttgtcttgac
aaccactgtcgtttccttcccttcagatagtgcatctgat
ggcagggatgacgaagccaaagacgaaaggtctgacatat
acgaatcgaaacggaatggacgctgttgccatcctgcctg
tggcaaatactatagttgtggacgctga
tgctccaggacc
ctctgaaccacgatatgccgccctctgcctgacctgcttc
actttccgtctctttgtgccactagaactctacaactcga
cccactagactcccacgttacctccgtattctgaaactac
ttggatttgattgtctttaatatctgctcatacttgctgt
tattacatcgtacaaaatttaaacaagaacatgaggggtg
tctgctcaaacaaaatcaggcaatgaccaggaaaaaagtc
tctgatctatckgaagactgtcaacctagtacactctact
taaccagtttttagaactgattaccactggagcttttgta
ccacatcaaccaygtctatgtgtaatgtttcgttttgcaa
actttactgtaattcttgacaaaaaagctcaaaatgtggg
aagcgcttttgattgtctgacaacttgtgatcatgtctct
tttcagcgagtctaagtgtatcctctgtgtgttttccttc
acctgttaagcaacgaaaagaggttgtccataatcagaaa
agcaaacgacaaagaactgcttgagaattraggttatata
tagggtaagcgaataaaaaaagcacagctgtgagaaatga
tgaaaacaacagataaaaaaattgaacaatacctacttgt
ttcatggttgatgatttcttttttaataatctttgtagac
attaatggcagtcctcckcccccatgccgttagttttttg
tttgtttgtttgttttttttgtctttctttctttatccaa
gatttgctgaatattatgaactgacaataaactgtcatag
gcacctaaaaaaaaaaaaaaaaaaacatgtc
Sequence translation MGMRMMFTVFLLVVLTTTVVSFPSDSASDGRDDEAKDERS
DIYESKRNGRCCHPACGKYYSCGR-

References

Internal links
Proteins Encoded CnIA/B/K precursor

External links
Ncbi
GenBank HE856366

Tools