Conus consors mRNA for A superfamily CnIE precursor, biomaterial CH070619AA-AC. (N02550) Nucleic Acid Card

General Information
Name Conus consors mRNA for A superfamily CnIE precursor, biomaterial CH070619AA-AC.
Organism Conus consors
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
tgg
atgatgttcactgtgtttctgttggttgtcttgacaa
ccactgtcgtttccttcccttcagatagtgcatctgatgg
cagggatgacgaagccaaagacgaaaggtctgacatgtac
gaattgaaacggaatggacgctgttgccatcctgcctgtg
gtggcaaatactttaaatgtggacgc
tgatgctccaggac
cctctgaactacgacatgccgccctctgcctgacctgctt
cactgtccgtctctttgtgccactacaactctacaactcg
acccactagaca
Sequence translation MMFTVFLLVVLTTTVVSFPSDSASDGRDDEAKDERSDMYE
LKRNGRCCHPACGGKYFKCGR

References

Internal links
Proteins Encoded CnIE/J precursor

External links
Ncbi
GenBank HE856369

Tools