Conus consors mRNA for A superfamily CnIL precursor, biomaterial CH070619AA-AC. (N02551) Nucleic Acid Card

General Information
Name Conus consors mRNA for A superfamily CnIL precursor, biomaterial CH070619AA-AC.
Organism Conus consors
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
tgtggcattacggccggggattcaactgacgagctgcaga
ccagacggacgtgaaacagcatcgccggcaagtggggata
gtacaagacacgcagaacaaagaagcagagagtctgagaa
aataacc
atgggcatgcggatgatgttcaccgtgtttctg
ttggttgtcttgacaaccactgtcgtttccttcccttcag
atagtgcatctgatggcagggatgacgaagccaaagacga
aaggtctgacatatacgaatcgaaacgggatggacgctgt
tgccatcctgcctgtggcaaatactatagttgtgggcgct
ga
tgctccaggaccctctgaaccacgatatgccgccctct
gcctgacctgcttcactttccgtctctttgtgccactaga
actctacaactcgacccactagactcccacgttacctccg
tattctgaaactacttggatttgattgtctttaatatctg
ctcatacttgctgttattacatcgtacaaaatttaaacaa
gaacatgaggggtgtctgctcaaacaaaatcaggcaatga
ccaggaaaaaagtctctgatctatccgaaaactgtcacct
gtcactctcttaaccagtttttagaactgattaccactgg
agcttttgtaccacatcaaccaggtctatgtgtaatgttt
cgttttgcaaactttgctgtaattcttgacaaaaaagctc
aaaatgtgggaagcgcttttgattgtctga
Sequence translation MGMRMMFTVFLLVVLTTTVVSFPSDSASDGRDDEAKDERS
DIYESKRDGRCCHPACGKYYSCGR-

References

Internal links
Proteins Encoded CnIA/B/L precursor

External links
Ncbi
GenBank HE856370

Tools