Cal12.2c mRNA, partial cds (N00259) Nucleic Acid Card

General Information
Name Cal12.2c mRNA, partial cds
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
cgtggcgtgtgcagcacgcccgaaggatcatgtgtccaca
acggatgcatatgtcagaacgcaccttgctgtcacccgtc
cggttgtaactgggccaatgtttgcccaggttacttatgg
gacaaaaac
tga
Sequence translation RGVCSTPEGSCVHNGCICQNAPCCHPSGCNWANVCPGYLW
DKN

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal12.2c

External links
Ncbi
GenBank EU022529

Tools