Conus marmoreus mRNA for Mr_precursor_038, complete cds. (N02598) Nucleic Acid Card

General Information
Name Conus marmoreus mRNA for Mr_precursor_038, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgcctcccagtcttcgtcattcttctgctactga
ttgcatctgcacctagcgttgatgcccgattgaagaccaa
agatgatatgcccttgccatcttcccacgctaacataaag
cgaaccctgcaaatgcttcggaacaaacgctgctgcccag
gctgggaattgtgctgcgagtgggatgatgggtgtaaagg
aaaatga
Sequence translation MRCLPVFVILLLLIASAPSVDARLKTKDDMPLPSSHANIK
RTLQMLRNKRCCPGWELCCEWDDGCKGK-

References
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J., Taft,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies BMC Genomics 14:708

Internal links
Proteins Encoded Mr038 precursor

External links
Ncbi
GenBank AB850732, AB850818

Tools