Conus caracteristicus Q-conotoxin peptide precursor (Ca6.2) mRNA, partial cds. (N02693) Nucleic Acid Card

General Information
Name Conus caracteristicus Q-conotoxin peptide precursor (Ca6.2) mRNA, partial cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgcacacactggaaatgctgctgctcgtcctgcttctgg
tgcccctggcacctggtgagggagatggacaagctgtggg
tggggacagaaaccccagtgaagcacgcagagcctacaaa
cgccttctgcaaagacccgccaggcgcatggacagaggcg
gttgcacaccctgtggcccgaacctctgctgcagcgaaga
attcagatgtggaacatcgacgcatcaccagacgtatggc
gagcctgcgtgtttaagttat
Sequence translation MHTLEMLLLVLLLVPLAPGEGDGQAVGGDRNPSEARRAYK
RLLQRPARRMDRGGCTPCGPNLCCSEEFRCGTSTHHQTYG
EPACLSY

References
Lu,A., Yang,L., Xu, S. and Wang,C. (2014) Various conotoxin diversifications revealed by a venomic study of Conus flavidus. Mol. Cell Proteomics 13:105-118

Internal links
Proteins Encoded Ca6.2 precursor

External links
Ncbi
GenBank KC582372

Tools