Conus flavidus Q-conotoxin peptide precursor (Fla6.17) mRNA, partial cds. (N02697) Nucleic Acid Card

General Information
Name Conus flavidus Q-conotoxin peptide precursor (Fla6.17) mRNA, partial cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgcacacactggaaatgctgctgctcctcctgcttctgt
tgcctctggcacctggtgagggagatggacaagctgtggc
aggggacagaaaccctggtgaagcacgcagtacccacaaa
cgctttctgcaaagacccgccaggcgcatacacagacata
ggtgcacaccgtgtggccctgatctctgctgcgagcctgg
aacaacatgtgacacagtgttgcgtcacacgcattttggc
gagccttcgtgttcatat
Sequence translation MHTLEMLLLLLLLLPLAPGEGDGQAVAGDRNPGEARSTHK
RFLQRPARRIHRHRCTPCGPDLCCEPGTTCDTVLRHTHFG
EPSCSY

References
Lu,A., Yang,L., Xu, S. and Wang,C. (2014) Various conotoxin diversifications revealed by a venomic study of Conus flavidus. Mol. Cell Proteomics 13:105-118

Internal links
Proteins Encoded Fla6.17 precursor

External links
Ncbi
GenBank KC582376

Tools