TSA: Conus victoriae O1_Vc6.37 mRNA sequence. (N02746) Nucleic Acid Card

General Information
Name TSA: Conus victoriae O1_Vc6.37 mRNA sequence.
Organism Conus victoriae
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgaaggtgagcagcgtgctgatcgtggctatgctgacac
tgaccgcaggccagctgattagtgcttcttcccattactc
agaagacgtccagatttctccttctgtgagatcagctgac
gaagtggaaaattccgagaatgtcaagctcagcaagagaa
aatgtatggaacaagggacatactgcagcctaatcttgtt
ctcctcatcatgttgcggggatttgtgtttgtttggtttc
tgcattctataa
Sequence translation MKVSSVLIVAMLTLTAGQLISASSHYSEDVQISPSVRSAD
EVENSENVKLSKRKCMEQGTYCSLILFSSSCCGDLCLFGF
CIL-

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Proteins Encoded Vc6.37 precursor

External links
Ncbi
GenBank GAIH01000054

Tools