Conus striatus kappaA-conotoxin SIVA precursor, mRNA, complete cds (N00282) Nucleic Acid Card

General Information
Name Conus striatus kappaA-conotoxin SIVA precursor, mRNA, complete cds
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcttggcaaccactgtcgtttccaccccttcagatcgtgc
atctgatggcaggaatgccgcagtccacgagagacagaag
agtctggtcccttcggtcatcacgacttgctgtggatatg
atccggggacaatgtgccctccttgcaggtgcactaatag
ctgtggt
taa
Sequence translation MGMRMMFTVFLLVVLATTVVSTPSDRASDGRNAAVHERQK
SLVPSVITTCCGYDPGTMCPPCRCTNSCG

References
Wang,C.Z., Jiang,H., Ou,Z.L., Chen,J.S. and Chi,C.W. (2003) cDNA cloning of two A-superfamily conotoxins from Conus striatus Toxicon 42:613-619

Internal links
Proteins Encoded SIVA precursor

External links
Ncbi
GenBank AY166873

Tools