Conus miles conopeptide Mi023 mRNA, complete cds. (N02824) Nucleic Acid Card

General Information
Name Conus miles conopeptide Mi023 mRNA, complete cds.
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcgtgttgatcatcgccgtgctgttcc
tgacagcctatcaactcgctacagctgcgagctacgccaa
aggtaaacagaagcatcgtgctctgaggccagctgacaaa
cacctcaggttgaccaagcgttgcaatgatcgcggtggag
gttgcagtcaacatcctcactgctgcggtggaacttgcaa
taagcttattggcgtatgtctgtaa
Sequence translation MKLTCVLIIAVLFLTAYQLATAASYAKGKQKHRALRPADK
HLRLTKRCNDRGGGCSQHPHCCGGTCNKLIGVCL-

References
Jin,A.H., Dutertre,S., Kaas,Q., Lavergne,V., Kubala,P. and Alewood,P.F. (2013) Transcriptomic messiness in the venom duct of Conus miles contributes to conotoxin diversity. Mol. Cell Proteomics 12:3824-3833

Internal links
Proteins Encoded MiEr93 precursor

External links
Ncbi
GenBank KP216838

Tools