Conus vexillum conotoxin Vx-VIa precursor, mRNA, complete cds (N00283) Nucleic Acid Card

General Information
Name Conus vexillum conotoxin Vx-VIa precursor, mRNA, complete cds
Organism Conus vexillum
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
aaccgtgcacggtgaatctagtttcagaattcttcactgc
cttctttgcactgccaaacacatcagcagg
atgaaactga
cgtgcgtgttgatcatcgccgtgctgttcctgacagccta
tcaactcgctacagctgcgagccacgccaaaggtaagcag
aagcatcgtgctctgaggccagctgacaaacacttcaggt
ttaccaagcgttgcaataatcgcggtggaggttgcagtca
acatcctcattgctgcagtggaacttgcaataagactttt
ggcgtatgtctg
taaagctggtctgccgtctgatattccc
tttcgttgctttatcctcttttgcctgagtcatccatacc
tgtgaatggttaagagccactcaatacctactcctctggg
ggcttcagaggaactactttacaataaaaccacattgcaa
tgaaaaaaaaaaaaaa
Sequence translation MKLTCVLIIAVLFLTAYQLATAASHAKGKQKHRALRPADK
HFRFTKRCNNRGGGCSQHPHCCSGTCNKTFGVCL

References
Jiang,H., Xu,C.Q., Wang,C.Z., Fan,C.X., Zhao,T.Y., Chen,J.S. and Chi,C.W. (2006) Two novel O-superfamily conotoxins from Conus vexillum Toxicon 47:425-436

Internal links
Proteins Encoded VxVIA precursor

External links
Ncbi
GenBank AF548000

Tools