Conus miles conopeptide Mi043 mRNA, complete cds. (N02843) Nucleic Acid Card

General Information
Name Conus miles conopeptide Mi043 mRNA, complete cds.
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtgtcgtttgacgtcactctgctgtttgctggtca
tcgtacttctgaactcggctgtggatggtgttccctgtca
acagggaggagggaagtgctcttcggatctgaaatgctgc
gacggccgtgatgtctgttgtggcacctccggaagtgcaa
cgtgcacaatagaaagtgagtgttctggggagcggattac
tcatacacaccgggcactacacgcccgtttcttcagacgt
tga
Sequence translation MMCRLTSLCCLLVIVLLNSAVDGVPCQQGGGKCSSDLKCC
DGRDVCCGTSGSATCTIESECSGERITHTHRALHARFFRR
-

References
Jin,A.H., Dutertre,S., Kaas,Q., Lavergne,V., Kubala,P. and Alewood,P.F. (2013) Transcriptomic messiness in the venom duct of Conus miles contributes to conotoxin diversity. Mol. Cell Proteomics 12:3824-3833

Internal links
Proteins Encoded Mi043 precursor

External links
Ncbi
GenBank KP216858

Tools