Conus eburneus delta conotoxin ErVIA precursor, gene, partial cds. (N02849) Nucleic Acid Card

General Information
Name Conus eburneus delta conotoxin ErVIA precursor, gene, partial cds.
Organism Conus eburneus
Organism Diet piscivorous
Organism Clade
Organism Region
Notes

Sequence
cgatccatctgtccatccatccattcattcatttgctgcc
aaactgtcataaatattcagctctgtctttcggtttgtat
ctgacag
attaaacaagaggtgcgctggtattggttcgtt
ttgtggcctaccaggcctagtggattgctgcagtgggagg
tgcttcatcgtttgcttgccgtga
tgtcttctcctcccct
c
Sequence translation IKQEVRWYWFVLWPTRPSGLLQWEVLHRLLAV?

References
Aman,J.W., Imperial,J.S., Ueberheide,B., Zhang,M.M., Aguilar,M., Taylor,D., Watkins,M., Yoshikami,D., Showers-Corneli,P., Safavi-Hemami,H., Biggs,J. and Olivera,B.M. (2015) Insights into the origins of fish hunting in venomous cone snails from studies of Conus tessulatus. Proc. Natl. Acad. Sci. U.S.A. 112:5087-5092

Internal links
Proteins Encoded ErVIA precursor

External links
Ncbi
GenBank KR013220

Tools