prohormone-4 mRNA (N02859) Nucleic Acid Card

General Information
Name prohormone-4 mRNA
Organism Conus victoriae
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
ATGTCTTCTCCGCTGAGAATGGATGTCACATTCTTGTTGG
CTGCCATTGCTGTCACGTGGGTATGTGGGCTAAAAATAGG
CTTCCCTGGATTCTCCACACCTCCGCGTTCCTTCATCCAG
CATCCTAAGCGGACCCTCTGTCCGGAGGACTGTGATATCG
CCAGCCCCTTCAAGTGTGAGGAGTCCCCGACCTGTCTTCG
TCTGTTCCAAGTGTGTAACGGCAGGTGGGACTGCGAGCAC
GGCTCCGACGAGGACAATGCCCTCTGCGCTGCTGTGCTCA
GGCCTCTTGAGTGCATGATTTGGGAATTCCTGGAGGGCCA
GAGAGACTGGATCCTCCCGAATCTCTTCAACGATGCAAAT
ACCGACCTGGTGGCCCATGCGCTCCACGAGGCCTACTCGA
TGGGAGACCTCCAGAGTTACCTGAATCTCACTGATCAGAA
CATAGAGAACATCCGCAACAGCACGCGGGGCGCCATTGTG
GGCGACCCACGCCCCCTCATGGCGCTGGGCATGCCTGATC
GAGCCTGGCCAGAGGTCATGTACCTGCTGAAGGAGCTCTA
CAACCTCGGCCTGGACGTCTGGGCCGAGTGA
Sequence translation MSSPLRMDVTFLLAAIAVTWVCGLKIGFPGFSTPPRSFIQ
HPKRTLCPEDCDIASPFKCEESPTCLRLFQVCNGRWDCEH
GSDEDNALCAAVLRPLECMIWEFLEGQRDWILPNLFNDAN
TDLVAHALHEAYSMGDLQSYLNLTDQNIENIRNSTRGAIV
GDPRPLMALGMPDRAWPEVMYLLKELYNLGLDVWAE-

References
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S. and Safavi-Hemami,H. (2017) Hormone-like peptides in the venoms of marine cone snails. Gen. Comp. Endocrinol. 244:11-18

Internal links
Proteins Encoded prohormone-4-Vc1 precursor

External links
Ncbi
GenBank GAIH01000103.1

Tools