Con-ins G1b mRNA (N02884) Nucleic Acid Card

General Information
Name Con-ins G1b mRNA
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
ATGACGACATCGTTCTACTTTCTGCTGATGGCCCTAGGCC
TTCTGCTGTACGTGTGTCAATCTTCCTTTGGCAACCAACA
TACCCGCACCTTTGATACTCCAAAGCACAGATGTGGATCA
GAGATCACTAATTCTTACATGGATCTGTGTTATCGCAAAA
GAAATGACGCAGGAGAGAAGAGAGGGCGGGCTTCCCCACT
GTGGCAGCGACGGGGCTTTCTCTCCAAGCTGAAGGCACGG
GCCAAGAGGAATGGAGCATTTCATCTGCCGAGAGACGGCC
GGGGTGTAGTCGAGCATTGTTGTCATCGTCCTTGCTCTAA
TGCAGAATTTAGGAAGTATTGTGGCTGA
Sequence translation MTTSFYFLLMALGLLLYVCQSSFGNQHTRTFDTPKHRCGS
EITNSYMDLCYRKRNDAGEKRGRASPLWQRRGFLSKLKAR
AKRNGAFHLPRDGRGVVEHCCHRPCSNAEFRKYCG-

References
Safavi-Hemami,H., Gajewiak,J., Karanth,S., Robinson,S.D., Ueberheide,B., Douglass,A.D., Schlegel,A., Imperial,J.S., Watkins,M., Bandyopadhyay,P.K., Yandell,M., Li,Q., Purcell,A.W., Norton,R.S., Ellgaard,L. and Olivera,B.M. (2015) Specialized insulin is used for chemical warfare by fish-hunting cone snails. Proc. Natl. Acad. Sci. U.S.A. 112:1743-1748

Internal links
Proteins Encoded Con-ins G1b precursor

External links
Ncbi
GenBank KP268607

Tools