TsIIIA precursor (N02943) Nucleic Acid Card

General Information
Name TsIIIA precursor
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
ATGATGTCTAAACTGGGAGTCTTGTTGACCATCTGTCTGC
TTCTGTTTCCCCTTACTGCTGTTCCGCTGGATGGAGATCA
ACCTGCAGACCAACCTGCAGAGCGTAAGCAGAACGAGCAG
CATCCCTTGTTTGACCAGAAAAGAGGGTGTTGCCGGTGGC
CATGCCCCAGTAGATGCGGCATGGCTAGGTGTTGCTCGTC
ATGA
Sequence translation MMSKLGVLLTICLLLFPLTAVPLDGDQPADQPAERKQNEQ
HPLFDQKRGCCRWPCPSRCGMARCCSS-

References
Yang,M., Zhao,S., Min,X., Shao,M., Chen,Y., Chen,Z. and Zhou,M. (2017) A novel μ-conotoxin from worm-hunting Conus tessulatus that selectively inhibit rat TTX-resistant sodium currents. Toxicon 130:11-18

Internal links
Proteins Encoded TsIIIA precursor

External links
Ncbi
GenBank JF510914.1

Tools